Beranda > Solusi Resep > Solusi Membuat Potato Bread

Solusi Membuat Potato Bread

makanan

Bahan-bahan

Tepung terigu protein tinngi 500 gram
Bread improver bisa tidak pakai. 2 sendok teh
Ragi Roti 2 1/2 sendok teh
Kentang matang 350 gram
Telur ukuran besar 1 butir
Gula pasir 50 gram
Unsalted Butter 75 gram
Susu Tawar UHT Hangat 125 ml
Garam 1 1/2 sendok teh
Untuk Fla
Tepung terigu protein sedang 60 gram
Susu tawar UHT 60 ml
Minyak goreng/olive oil 1 sendok teh
Gula pasir 15 gram

Cara membuat

1

W1siziisijiwmtqvmdkvmtcvmtmvntuvmzgvntcylzdjnzy0mtqwmdbjy2mxnwe0ngjklmpwzyjdlfsiccisimnvbnzlcnqilcityxv0by1vcmllbnqgil0swyjwiiwidgh1bwiilcixodb4il1d?sha=ca03e58c
Seduh ragi dengan 50 ml susu hangat dan 1 sdt gula .Aduk aduk dan diamkan selama 8 menit sampai berbusa.

2

W1siziisijiwmtqvmdkvmtcvmtmvntgvmtkvns83yjvhzddlmtc3yzaznmi5mdq4mc5qcgcixsxbinailcjjb252zxj0iiwilwf1dg8tb3jpzw50icjdlfsiccisinrodw1iiiwimtgwecjdxq?sha=0db94008
Lembutkan kentang dengan Garpu sampai lembut. Bisa pakai dengan alat lainnya.

3

W1siziisijiwmtqvmdkvmtcvmtqvmdavndcvnjg1lzzjnge5yjnlytyxzgnhnwflmtc0lmpwzyjdlfsiccisimnvbnzlcnqilcityxv0by1vcmllbnqgil0swyjwiiwidgh1bwiilcixodb4il1d?sha=6c88ee9f
Dimangkok besar Ayak Tepung. Lalu campur dengan Bread improver jika pakai.tambahkan garam dan gula aduk sampai campur. Masukkan Butter remas remas ditepung. Sampai scramble.

4

W1siziisijiwmtqvmdkvmtcvmtqvmdmvntgvnzgxlzmymzm2mzi2mdm1zjawzgmwzjhllmpwzyjdlfsiccisimnvbnzlcnqilcityxv0by1vcmllbnqgil0swyjwiiwidgh1bwiilcixodb4il1d?sha=54eb416c
Tambahkan kentang yang sudah di lembutkan campurkan ditepung sampai rata.

5

W1siziisijiwmtqvmdkvmtcvmtqvmduvmzyvnzk1l2exoguyymvmzthinmqznjk5nzgwlmpwzyjdlfsiccisimnvbnzlcnqilcityxv0by1vcmllbnqgil0swyjwiiwidgh1bwiilcixodb4il1d?sha=23e6b631
Masukkan cairan ragi dan telur. Aduk perlahan lahan dengan tangan sambil tuangkan dikit demi sedikit sisa susu. Untuk susu tergantung Dari kelembapannya kentang. Setelah Semua campur rehat kan adonan selama 5 menit dengan ditutup kain.

6

W1siziisijiwmtqvmdkvmtcvmtqvmdgvmdqvntmvy2y1nwjjzje4nzg0zgzkywrmndauanbnil0swyjwiiwiy29udmvydcisii1hdxrvlw9yawvudcaixsxbinailcj0ahvtyiisije4mhgixv0?sha=2d543955
Keluarkan adonan ke permukaan lalu uleni selama 10 menit. Untuk lebih cepat pukul in adonan dengan rolling pin ini lebih cepat lembut nya cukup 5 menit sudah lembut sekali.

7

W1siziisijiwmtqvmdkvmtcvmtqvmtmvmtgvntcxlzrmzme2ymrkyjy4ztnjnje4mmmzlmpwzyjdlfsiccisimnvbnzlcnqilcityxv0by1vcmllbnqgil0swyjwiiwidgh1bwiilcixodb4il1d?sha=6971b3d5
Bulatkan adonan lumurin dengan sedikit minyak lalu tempat kan di mangkok besar tutup dengan kain bersih. Biarkan selama 45 menit atau sampai 1 jam untuk mengembang 2x lipat.

8

Kempiskan adonan sampai tidak berangin. Lalu Adonan roti siap dibentuk sesuka masing masing. Jika saya biasa nya untuk 1 roti dengan berat 75 g.

9

W1siziisijiwmtqvmdkvmtcvmtqvmtgvntqvnjuvytywyzvknmy2yjjmmtbkowy5ztkuanbnil0swyjwiiwiy29udmvydcisii1hdxrvlw9yawvudcaixsxbinailcj0ahvtyiisije4mhgixv0?sha=09c45ec0
Untuk membuat vla. Campur tepung. Gula dan minyak tuangkan susu dikit demi sedikit. Biasa nya susu tidak masuk semua. Adonan vla harus kental tidak encer. Gunakan spuit untuk membentuk diatas adonan roti.

10

W1siziisijiwmtqvmdkvmtcvmtqvmjgvmtkvnty5lzuwymjhyjjizwrhm2i5yzmzmjg0lmpwzyjdlfsiccisimnvbnzlcnqilcityxv0by1vcmllbnqgil0swyjwiiwidgh1bwiilcixodb4il1d?sha=8b6f4bbf
Jika Adonan roti yang sudah dibentuk mengembang hampir 2x lipat .roti siap dipanggang di oven yang sudah panas dengan suhu 180 derajat selama 15 menit.

11

Siapkan bahan untuk poles. Yang diatas tidak saya cantumkan bahannya. Untuk poles:1 sdm butter lembutkan bersama 1 sdt madu. Begitu roti dikeluarkan dari oven langsung poles dengan campuran tersebut.

.

 

 

 

.
sumber: dapurmasak.com/resep/potato-bread-9778

  1. Belum ada komentar.
  1. No trackbacks yet.

Tinggalkan Balasan

Isikan data di bawah atau klik salah satu ikon untuk log in:

Logo WordPress.com

You are commenting using your WordPress.com account. Logout / Ubah )

Gambar Twitter

You are commenting using your Twitter account. Logout / Ubah )

Foto Facebook

You are commenting using your Facebook account. Logout / Ubah )

Foto Google+

You are commenting using your Google+ account. Logout / Ubah )

Connecting to %s

%d blogger menyukai ini: